PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013610486.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 340aa    MW: 38937.2 Da    PI: 6.5058
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013610486.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed++l+d ++++G g+W++ ++  g++R++k+c++rw +yl
   XP_013610486.1 14 KGPWTQDEDDKLIDHIQKHGHGSWRALPKQAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.92.1e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE+e +++++ +lG++ W++Ia+ ++ +Rt++++k++w+++l
   XP_013610486.1  67 RGSFTAEEEETIINLHSLLGNK-WSSIASNLP-RRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.551961IPR017930Myb domain
SuperFamilySSF466891.32E-3011108IPR009057Homeodomain-like
SMARTSM007176.0E-151363IPR001005SANT/Myb domain
PfamPF002491.1E-161461IPR001005SANT/Myb domain
CDDcd001673.71E-111661No hitNo description
PROSITE profilePS5129427.24262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.1E-2765116IPR009057Homeodomain-like
SMARTSM007171.5E-1666114IPR001005SANT/Myb domain
PfamPF002495.4E-1667112IPR001005SANT/Myb domain
CDDcd001678.42E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTQD EDDKLIDHIQ KHGHGSWRAL PKQAGLNRCG KSCRLRWTNY  60
LRPDIKRGSF TAEEEETIIN LHSLLGNKWS SIASNLPRRT DNEIKNYWNT HLRKKLLQMG  120
IDPVTHRPRT DHLNVLAALP QLIAAANFKS LLNLNQNVQL DATTLAKAQI LHNIIQVLST  180
NNNNNPSSWP LAMQTSDNLF GQSSYLENQN LFGQSQNLSH ILENSHDEDF IVKNQTIDHP  240
LDSFSSPMQM DVQDDHYSLP LLVSGSPEES KQSQIKIKNK DIVHDQHHHR DTSNPSSTNS  300
TFTQDHHRPW CDTTIDDETS DSYWKDIIEQ TCSEPWRFPE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-291211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895010.0AC189501.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB087B10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013610486.10.0PREDICTED: myb-related protein 330
SwissprotQ8GWP05e-75MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0D3EEY00.0A0A0D3EEY0_BRAOL; Uncharacterized protein
STRINGAT5G16770.10.0(Arabidopsis thaliana)
STRINGfgenesh2_kg.6__1669__AT5G16770.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.20.0myb domain protein 9